RESEARCH USE ONLY.
Designed for laboratory handling by qualified experts only.

Novera IGF-1 LR3

Coming Soon!

$131.00

Specifications
Category:
Brand Novera
Strength 1mg
Form Lyophilized powder
Purity (%) ≥99
CAS number 946870-92-4
Chemical Formula C₃₈₅H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight 9111–9112
Synonyms IGF-1 LR3, Long R3 IGF-1, Long Arg3 Insulin-Like Growth Factor
Peptide sequence MFPAMPLSSLFVNGPRTLCGGELVDALQFVDNTPKTKTGIVDECCFRSCDLRRLEMYCAPLKPAKSAFPTTGGHVDSSRVPESKSRVTRR
Storage Store at 2-8 °C. Protect from light and moisture
Shelf Life (lyophilized) 18-24 months
Shelf Life (after reconstitution) 7-28 days

Found a Better Price?
If you see the same product for less elsewhere, we'll gladly try to match it!
Learn more...

Estimated Delivery Time: 3-7 Days
Free Shipping Over: $750

Novera IGF-1 LR3 is a laboratory-grade peptide based on insulin like growth factor 1 long R3 IGF, a modified form of insulin-like growth factor designed for experimental applications. Unlike the naturally occurring molecule, this version contains a long arginine substitution and several sequence changes that reduce its interaction with IGF binding proteins, allowing it to remain available for a longer period under controlled experimental conditions.

The product is typically supplied as a sterile white powder that requires proper reconstitution before use in laboratory work. Depending on the manufacturer, documentation may include batch-specific certificates, verified analytical reports, and information about purity to support quality assessment before experiments begin. These records help maintain transparency throughout the scientific research process and allow investigators to compare different production lots with greater confidence.

Composition and Structural Features

IGF-1 LR3 belongs to a group of IGF i variants created to modify the behavior of the native molecule without changing its overall biological purpose. IGF-1 LR3 has an 83 amino acid structure. The additional amino acid sequence at the N-terminus and the modified position within the peptide reduce binding to regulatory proteins, extending biological activity in laboratory observations.

Key Structural Characteristics

  • Modified peptide sequence with enhanced persistence;
  • Reduced affinity for IGF binding proteins;
  • High manufacturing purity verified through analytical testing;
  • Standard presentation as lyophilized material for laboratory preparation.

How Does IGF-1 LR3 Work

The primary biological target of IGF-1 LR3 is the IGF-1 receptor, a membrane protein involved in regulating multiple intracellular signaling pathways. After receptor activation, a complex pathway of molecular events influences cell growth, protein synthesis, cell proliferation, and cellular metabolism. These mechanisms explain why the peptide remains an interesting tool for experimental biology.

One reason scientists continue investigating this analogue is its reduced interaction with regulatory proteins, which allows prolonged receptor exposure under carefully controlled laboratory settings. This characteristic makes it easier to observe biological responses over longer experimental periods without the rapid binding seen with endogenous IGF-1. Areas commonly examined include:

  • Regulation of cellular proliferation;
  • Mechanisms involved in differentiation;
  • Signaling associated with muscle development;
  • Changes affecting nutrient uptake;
  • Interactions with cellular glucose metabolism.

IGF-I LR3 Research Use

Modern researchers investigate IGF-1 LR3 across many disciplines because growth factor signaling influences a wide variety of biological processes. In regenerative biology, scientists examine how growth factor activity contributes to tissue maintenance and cellular repair. Other projects explore how signaling changes affect survival during environmental stress or nutrient restriction.

Experimental work has also examined relationships between IGF signaling and myostatin, since both participate in regulating skeletal tissue adaptation. This has made the peptide relevant when studying mechanisms connected with hypertrophy, although observations from laboratory models should not be interpreted as direct evidence for humans.

Current Areas of Scientific Interest

  • Cellular signaling during tissue repair;
  • Molecular regulation of growth;
  • Experimental models of age-related biological change;
  • Studies related to endocrinology;
  • Investigations involving metabolic regulation and diabetes.

Possible Side Effects Observed During Research Studies

Although IGF-1 LR3 is not intended for therapeutic administration, published literature discussing experimental exposure has identified several biological effects that continue to receive attention. Depending on the model being tested, changes in metabolic activity, altered signaling intensity, or unexpected cellular responses may occur. Prolonged exposure to IGF-1 LR3 increases the risk of adverse reactions. Potential observations described across experimental literature include:

  • Altered glucose handling;
  • Increased signaling activity;
  • Changes in cellular metabolism;
  • Unexpected biological variability between experimental systems.

IGF-1 LR3 is banned by many athletic organizations and anti-doping agencies. Serious risks of IGF-1 LR3 include severe hypoglycemia and organ enlargement. Consultation with a healthcare professional is recommended for hormonal health.

The ability of cells to respond may differ considerably depending on tissue type, concentration, exposure time, and overall protocol design. For this reason, reproducibility remains a critical consideration whenever results are interpreted or compared across independent laboratories.

Insulin Like Growth Factor 1 Storage and Handling

Proper storage plays an important role in maintaining peptide stability and experimental integrity. Most manufacturers recommend storing the lyophilized product in a cool, dry environment protected from excessive moisture and repeated temperature fluctuations. After reconstitution, laboratories generally prepare small working aliquots to reduce repeated freeze-thaw cycles. Good laboratory practice usually includes:

  • Keeping containers tightly sealed;
  • Recording preparation dates;
  • Avoiding contamination during handling;
  • Using calibrated storage equipment.

Maintaining accurate documentation is equally important because sample quality influences every stage of subsequent analysis. Careful handling helps preserve the peptide throughout the complete duration of a study and supports consistent experimental performance.

While some suppliers distribute products internationally, including the USA, the peptide remains intended exclusively for scientific investigation. It is not designed for veterinary applications or consumer use, and published findings should always be interpreted within the limits of controlled research rather than practical medical recommendations.

Where to Buy IGF-1 LR3

Researchers looking for dependable laboratory materials often choose OGOmed because every product is utilized with scientific applications in mind and supported by detailed quality documentation. Clear specifications, batch consistency, and well-defined handling information are essential for maintaining reliable results in research settings, where even small variations can lead to differences in experimental outcomes. This focus on quality control makes OGOmed a practical source for laboratories that value reproducibility, traceability, and carefully documented research materials.

Specifications
Category:
Brand Novera
Strength 1mg
Form Lyophilized powder
Purity (%) ≥99
CAS number 946870-92-4
Chemical Formula C₃₈₅H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight 9111–9112
Synonyms IGF-1 LR3, Long R3 IGF-1, Long Arg3 Insulin-Like Growth Factor
Peptide sequence MFPAMPLSSLFVNGPRTLCGGELVDALQFVDNTPKTKTGIVDECCFRSCDLRRLEMYCAPLKPAKSAFPTTGGHVDSSRVPESKSRVTRR
Storage Store at 2-8 °C. Protect from light and moisture
Shelf Life (lyophilized) 18-24 months
Shelf Life (after reconstitution) 7-28 days

Found a Better Price?
If you see the same product for less elsewhere, we'll gladly try to match it!
Learn more...

Estimated Delivery Time: 3-7 Days
Free Shipping Over: $750